{ "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", "dialogTitleHeadingLevel" : "2", "event" : "markAsSpamWithoutRedirect", "actions" : [ ] Bist du sicher, dass du fortfahren möchtest? "kudosable" : "true", { "useTruncatedSubject" : "true", "actions" : [ In der Regel haben Vodafone Mobile Verträge eine Laufzeit von 24 Monaten und eine … ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, ] "context" : "", "actions" : [ "disallowZeroCount" : "false", ] Das soll in Zukunft aufgrund der neuen Regelungen nicht mehr möglich sein. ] } Du kannst aber die Kündigung verschieben. "context" : "", $(document).ready(function(){ } "displayStyle" : "horizontal", }, "messageViewOptions" : "1111110111111111111110111110100101001101", { "action" : "rerender" { "message" : "2708529", }, }, } }, "entity" : "2708529", }); "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, } LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; })(LITHIUM.jQuery); } } "forceSearchRequestParameterForBlurbBuilder" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } { { } ] element.addClass('active'); }, "context" : "", } Bist du sicher, dass du fortfahren möchtest? ] ] "context" : "envParam:quiltName,product,contextId,contextUrl", { { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "action" : "rerender" } "}); "action" : "rerender" } lithadmin: [] // Reset the conditions so that someone can do it all again. "action" : "rerender" } "context" : "envParam:entity", "useTruncatedSubject" : "true", "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "event" : "MessagesWidgetCommentForm", ', 'ajax'); "actions" : [ } "actions" : [ "action" : "rerender" "action" : "rerender" { }, { "event" : "kudoEntity", $(document).ready(function(){ } "event" : "MessagesWidgetEditAction", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); ], "event" : "editProductMessage", "initiatorDataMatcher" : "data-lia-kudos-id" }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, }, }, "event" : "QuickReply", { ] }, "action" : "pulsate" ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "MessagesWidgetEditAnswerForm", ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); Bist du sicher, dass du fortfahren möchtest? // Your code here... "context" : "", }, }, { "action" : "rerender" "event" : "QuickReply", "action" : "rerender" } "actions" : [ ] // enable redirect to login page when "logmein" is typed into the void =) } Deine Kündigungsfrist bei Vodafone ist abhängig von deinem Vertrag. ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, ] ] "actions" : [ "useSubjectIcons" : "true", "context" : "envParam:feedbackData", }, "event" : "removeMessageUserEmailSubscription", "event" : "editProductMessage", { } else { }, "event" : "removeMessageUserEmailSubscription", ] } "event" : "MessagesWidgetEditAction", "event" : "RevokeSolutionAction", }, ] { "context" : "", "forceSearchRequestParameterForBlurbBuilder" : "false", { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); { "action" : "rerender" ] "event" : "deleteMessage", }, "context" : "", } "context" : "", { { } { "displayStyle" : "horizontal", ] $(document).ready(function(){ (function($) { } "context" : "envParam:quiltName,expandedQuiltName", "context" : "", { "componentId" : "forums.widget.message-view", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "truncateBody" : "true", } ] Mobilfunkanschluss kombiniert mit einem Smartphone) haben Sie nun stärkere Kundenrechte. // console.log(key); "}); { "event" : "RevokeSolutionAction", "disallowZeroCount" : "false", "context" : "", })(LITHIUM.jQuery); ] } }, ] }, var keycodes = { watching = false; { Execute whatever should happen when entering the right sequence "dialogKey" : "dialogKey" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "showCountOnly" : "false", "showCountOnly" : "false", "context" : "", { "event" : "removeThreadUserEmailSubscription", ] ] } ] "useTruncatedSubject" : "true", "quiltName" : "ForumMessage", { { ] { { "showCountOnly" : "false", ] "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ { }, "context" : "envParam:quiltName,product,contextId,contextUrl", // Your code here... border: 8px solid transparent; { }, LITHIUM.AjaxSupport.ComponentEvents.set({ "eventActions" : [ "event" : "removeMessageUserEmailSubscription", "eventActions" : [ lithstudio: [], "context" : "envParam:quiltName", { "action" : "rerender" ] "action" : "rerender" { { }, // Set start to true only if the first key in the sequence is pressed "useTruncatedSubject" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); }, LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "truncateBodyRetainsHtml" : "false", } { "action" : "pulsate" } }, ] "action" : "rerender" } "action" : "rerender" "actions" : [ count++; "event" : "removeThreadUserEmailSubscription", //$('#lia-body').removeClass('lia-window-scroll'); "event" : "deleteMessage", { "context" : "envParam:feedbackData", "action" : "rerender" "action" : "rerender" "event" : "kudoEntity", return; { ', 'ajax'); }); { ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_2.lineardisplaymessageviewwrapper_0:renderinlineeditform?t:ac=board-id/123456/thread-id/258545","ajaxErrorEventName":"LITHIUM:ajaxError","token":"uuMw0s35VMG_ULmF3DqtmKXKbo7NO00w5zUbTKXbSxM. "actions" : [ ] ] "action" : "pulsate" "event" : "kudoEntity", }; { "event" : "AcceptSolutionAction", ] { ] ] ] "event" : "ProductAnswerComment", "action" : "rerender" { "context" : "", "action" : "pulsate" "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ (function () { "disableKudosForAnonUser" : "false", "event" : "approveMessage", "actions" : [ }); { }); }); "initiatorBinding" : true, { { "initiatorBinding" : true, $('div[class*="-menu-btn"]').removeClass('active'); "context" : "", "initiatorBinding" : true, LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } Es gilt in der Regel eine dreimonatige Kündigungsfrist zum Monatsende. "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'hlYRNGxoPaebH2M701GwpbR13gD40GJkQchF1i5GsrI. ] ja dann würde man schnell draufkommen da sie keine schicken müssen und das hier ein Kunden helfen Kunden Forum ist! "kudosLinksDisabled" : "false", "initiatorDataMatcher" : "data-lia-message-uid" ;(function($) { "event" : "kudoEntity", { { let markup = ` "actions" : [ ] LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "MessagesWidgetMessageEdit", } }, ] "action" : "rerender" }, "action" : "rerender" "context" : "", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":274329}); }); watching = false; "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); $(document).ready(function(){ { ], $(document).ready(function(){ Deine Kündigungsfrist bei Vodafone ist abhängig von deinem Vertrag. "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "addThreadUserEmailSubscription", { "actions" : [ ] } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); // Reset the conditions so that someone can do it all again. "ajaxEvent" : "LITHIUM:lightboxRenderComponent", Mit der Telekommunikationsnovelle bekommen Sie Möglichkeiten, bei schlechten Leistungen des Anbieters zu reagieren. "kudosLinksDisabled" : "false", { { if ( count == neededkeys.length ) { "actions" : [ } "actions" : [ "disableLinks" : "false", }, "selector" : "#kudosButtonV2_3", ] Vodafone erhöht seit Mai 2023 die Preise für Internet-Anschlüsse von Bestandskund:innen. "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" "action" : "pulsate" Diese Einschränkung müssen Sie nachweisen. ] "actions" : [ { { "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); if ( count == neededkeys.length ) { "context" : "envParam:entity", "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" { LITHIUM.Dialog.options['1468807225'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; { "actions" : [ ] "context" : "envParam:selectedMessage", "event" : "QuickReply", "actions" : [ "actions" : [ "action" : "pulsate" { ] LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); ] "context" : "", } { }, "}); "action" : "rerender" }, "event" : "MessagesWidgetEditAction", Häufige Fragen. } { }, { { "displayStyle" : "horizontal", "action" : "rerender" "context" : "", }, $('#community-menu-toggle').click(function() { } } ] "context" : "", "context" : "", "entity" : "2708549", }, } "parameters" : { } "context" : "envParam:quiltName,message", } "event" : "addMessageUserEmailSubscription", "actions" : [ "accessibility" : false, "eventActions" : [ { "context" : "envParam:selectedMessage", "event" : "MessagesWidgetMessageEdit", "actions" : [ "truncateBodyRetainsHtml" : "false", Der vzbv forderte in einer Stellungnahme eine Mindestversorgung von 30 Mbit/s im Download und 2,3 Mbit/s im Upload. "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" "triggerEvent" : "click", ] LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); Wichtig ist außerdem das "Recht auf schnelles Internet". "action" : "rerender" }, "actions" : [ $(this).toggleClass('active'); "context" : "envParam:selectedMessage", { } { "event" : "approveMessage", } } ] ] "actions" : [ "event" : "ProductMessageEdit", "event" : "editProductMessage", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "actions" : [ "actions" : [ { ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2708524 .lia-rating-control-passive', '#form_1'); })(LITHIUM.jQuery); "selector" : "#kudosButtonV2_5", "event" : "unapproveMessage", "actions" : [ }, "; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductAnswer", var keycodes = { "messageViewOptions" : "1111110111111111111110111110100101001101", }, "disableLabelLinks" : "false", }, }, "action" : "rerender" // console.log(key); // Oops. const pageName = LITHIUM.Components.ORIGINAL_PAGE_NAME; "eventActions" : [ } Wahrt der Kunde die Frist nicht, verlängert sich der Vertrag um weitere 12 Monate. }, ', 'ajax'); "action" : "rerender" ] { Tipp: Seit Dezember 2021 gelten dank einer Gesetzesänderung ( TKG-Novelle) verbesserte Verbraucherrechte und schnellere Kündigungsmöglichkeiten. }, "context" : "", (function($) { "actions" : [ "context" : "", } "context" : "", "context" : "", position: absolute; }, "context" : "envParam:feedbackData", {